top of page
  • Pinterest
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Gluten Free Blueberry & Raspberry Biscuit Break Chunky 160g

£3.09Price

Gluten Free Blueberry & Raspberry Biscuit Break Chunky 160g, At Nairn's, we're passionate about baking. We've recently created a chunky variety of our popular biscuit breaks range for you to enjoy — with a light, crumbly texture and deliciously full of flavour, they are perfect for those looking for something a little bit chunkier to have with a cuppa.

Bursting with the flavour of juicy blueberries and tangy raspberries, they're sure to be a winner with the whole family.

Our tasty Chunky Biscuit Breaks come in handy pouch packs making them easy to pop in your bag for a mid-morning or afternoon snack on the go. Or simply enjoy them as the perfect accompaniment to your favourite hot or cold drink at any time of day.

Ingredients

Gluten Free Wholegrain Oats (63%), Sustainable Palm Fruit Oil, Brown Sugar, Blueberries (3.5%) (Blueberry, Sugar, Sunflower Oil), Tapioca Starch, Partially Inverted Refiners Syrup; Lyles Golden Syrup, Raising Agents (Sodium Bicarbonate, Ammonium Bicarbonate), Raspberry Pieces (1%) (Raspberry, Apple Juice Concentrate, Citrus Pectin, Apple Powder), Currants (1%) (Currants, Sunflower Oil), Sea Salt, Natural Flavouring.

Allergy Advice

Both our recipe and factory are nut free. We cannot guarantee that our ingredients are nut free. Manufactured on equipment that handles milk.

Not suitable if you react to Avenin - a protein in oats.

Quantity
Out of Stock
Get to know
The Courtyard Marketplace

HELP

FOLLOW US

Shop

Our Suppliers

About

Recipes

Contact

Visit Our Shop

8 West Street,

Wilton Town Centre,

Wiltshire

SP2 0DF

©2025 by The Courtyard Marketplace. Privacy Policy. Terms & Conditions. Built by An.X Ltd.

bottom of page