top of page
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Blood Orange Curd 310g

Blood Orange Curd 310g

£4.10Price

Currently unique to the Thursday Cottage brand in the preserves market, this fruity curd is a lovely vibrant alternative to the classic flavour curds. You can certainly taste the different between our Blood Orange Curd and a standard Orange Curd because of the sweetness the Blood Orange carries alongside its bitter notes. Try it for yourself and see what you think, you won’t regret it!

Sugar, Blood Orange Concentrate (19%), Pasteurised Free Range Egg,

Pasteurised Free Range Egg Yolk, Butter (Milk, Salt), Acidity

Regulator: Citric Acid, Gelling Agent: Citrus Pectin, Natural Orange

Flavour

For allergens, see ingredients in bold

NUTRITIONAL INFORMATION TYPICAL VALUES per 100g. Energy 1696 kJ/404 kcal, Fat 13g of which saturates 6.3g, Carbohydrate 67g of which sugars 67g, Protein 4.2g, Salt 0.24g.

Related Products

bottom of page